Protein Info for ABZR87_RS14745 in Ralstonia sp. UNC404CL21Col

Annotation: urease subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00547: Urease_gamma" amino acids 1 to 99 (99 residues), 160.5 bits, see alignment E=5.8e-52 TIGR00193: urease, gamma subunit" amino acids 1 to 99 (99 residues), 176.1 bits, see alignment E=7.5e-57

Best Hits

Swiss-Prot: 100% identical to URE3_RALPJ: Urease subunit gamma (ureA) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01430, urease subunit gamma [EC: 3.5.1.5] (inferred from 100% identity to rpi:Rpic_2187)

MetaCyc: 69% identical to urease gamma subunit (Sinorhizobium meliloti Rm2011)
Urease. [EC: 3.5.1.5]

Predicted SEED Role

"Urease gamma subunit (EC 3.5.1.5)" in subsystem Urea decomposition (EC 3.5.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.5

Use Curated BLAST to search for 3.5.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>ABZR87_RS14745 urease subunit gamma (Ralstonia sp. UNC404CL21Col)
MELTPREKDKLLIFTAALLAERRKGRGLKLNYPEAVAFISAAIMEGARDGKTVADLMHYG
TTLLTRNDVMDGVAEMIPDIQVEATFPDGTKLVTVHHPIV