Protein Info for ABZR87_RS14740 in Ralstonia sp. UNC404CL21Col

Annotation: HupE/UreJ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 66 (25 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 124 to 140 (17 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF04955: HupE_UreJ" amino acids 16 to 200 (185 residues), 184.7 bits, see alignment E=5.7e-59

Best Hits

KEGG orthology group: K03192, urease accessory protein (inferred from 98% identity to rpi:Rpic_2186)

Predicted SEED Role

"HupE-UreJ family metal transporter" in subsystem Transport of Nickel and Cobalt or Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>ABZR87_RS14740 HupE/UreJ family protein (Ralstonia sp. UNC404CL21Col)
MTPTLSRFVRPAAAIALTFGASIAFAHPGHPGHTAEGSLLAGFLHPLTGADHLLAMVAVG
VWSALASRSVRDALWAPVAFVALMILGALLGAGGVAVPMAEPMIAASLLVFGLLIAARAQ
LPTWGGALLCGAFALFHGYAHGTEFPAGAQAMFPYFVGGFAVATALLHTAGIGAGFALKP
RLAWLARLSGVGVALYGAGLLVTAI