Protein Info for ABZR87_RS14725 in Ralstonia sp. UNC404CL21Col

Annotation: urease accessory protein UreE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02814: UreE_N
  • amino acids 13 to 71 (59 residues), 74.4 bits, E=4.2e-25
• PF05194: UreE_C
  • amino acids 78 to 182 (105 residues), 39.2 bits, E=7.1e-14

Best Hits

Swiss-Prot: 86% identical to UREE_RALSO: Urease accessory protein UreE (ureE) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03187, urease accessory protein (inferred from 93% identity to rpf:Rpic12D_1860)

Predicted SEED Role

"Urease accessory protein UreE" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

Protein Sequence (220 amino acids)

>ABZR87_RS14725 urease accessory protein UreE (Ralstonia sp. UNC404CL21Col)
MLSINKHLPAPHGLASVLVKRAPKLVLPFLERSRSRLRATLDDGREVAVVLPRGTVMRGG
DVLVAEDGTLVEVQAAPEQVLRVSSDNRLALMRAAYHLGNRHTPVQVSADALQLEADPVL
EDMLVRLGVTVAHVEAPFEPEAGAYGGGHRHGHDATFEEDYAAAQALYHEHHGHDHGHSH
AHDHDHGHSHSHDHAHGHGHDHDHGHVHGPGCGHHHHHHD