Protein Info for ABZR87_RS14715 in Ralstonia sp. UNC404CL21Col

Annotation: urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 9 to 202 (194 residues), 330.3 bits, E=2.1e-103
• PF02492: cobW
  • amino acids 11 to 181 (171 residues), 141 bits, E=1.6e-45

Best Hits

Swiss-Prot: 99% identical to UREG_RALPJ: Urease accessory protein UreG (ureG) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03189, urease accessory protein (inferred from 99% identity to rpi:Rpic_2181)

MetaCyc: 64% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

Protein Sequence (207 amino acids)

>ABZR87_RS14715 urease accessory protein UreG (Ralstonia sp. UNC404CL21Col)
MRTKKLPALRVGVGGPVGSGKTTLLEMLCKAMRERYDLVAITNDIYTKEDQRLLTISGAL
PAERIMGVETGGCPHTAIREDASINLEAVDRMLSKFPDADVVFIESGGDNLAATFSPELS
DLTIYVIDVAGGEKIPRKGGPGITKSDLLIINKTDLAPYVGASLEVMESDTRKMRGDRPF
VMCNLRAQGGLDEVIRFIEKQGMLVGG