Protein Info for ABZR87_RS14655 in Ralstonia sp. UNC404CL21Col

Annotation: 3-hydroxyacyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02826: 2-Hacid_dh_C
  • amino acids 12 to 74 (63 residues), 25.3 bits, E=1.8e-09
• PF02737: 3HCDH_N
  • amino acids 24 to 202 (179 residues), 211.5 bits, E=1.8e-66
• PF03446: NAD_binding_2
  • amino acids 24 to 94 (71 residues), 27.6 bits, E=5.6e-10
• PF00725: 3HCDH
  • amino acids 205 to 302 (98 residues), 91.7 bits, E=7.2e-30
  • amino acids 432 to 513 (82 residues), 66.4 bits, E=5.6e-22

Best Hits

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 98% identity to rpi:Rpic_2168)

MetaCyc: 73% identical to 3-hydroxyacyl-CoA dehydrogenase (Cupriavidus necator H16)
3-hydroxyacyl-CoA dehydrogenase. [EC: 1.1.1.35]

Predicted SEED Role

"3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) / Enoyl CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 1.1.1.35, EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• fatty acid salvage (6/6 steps found)
• adipate degradation (5/5 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• phenylacetate degradation I (aerobic) (7/9 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• adipate biosynthesis (4/5 steps found)
• superpathway of phenylethylamine degradation (8/11 steps found)
• 2-methyl-branched fatty acid β-oxidation (10/14 steps found)
• L-isoleucine degradation I (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• valproate β-oxidation (6/9 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• L-valine degradation I (5/8 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (11/17 steps found)
• 6-gingerol analog biosynthesis (engineered) (3/6 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (8/13 steps found)
• glycerol degradation to butanol (10/16 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• methyl tert-butyl ether degradation (4/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
• toluene degradation VI (anaerobic) (4/18 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Bile acid biosynthesis
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157, 1.1.1.35, 4.2.1.17

Use Curated BLAST to search for 1.1.1.157 or 1.1.1.35 or 4.2.1.17

Protein Sequence (523 amino acids)

>ABZR87_RS14655 3-hydroxyacyl-CoA dehydrogenase (Ralstonia sp. UNC404CL21Col)
MPEIARSCYFSQTSFDRSGFHMQTIGIVGTGAMGRGIAQIAAQAGLRVKLFDANSQAVEA
ARTALADTLAKLAAKGKMTAEEADATVARLIPAGALADLADCDLVVEAIVEKLDVKRDLF
RQLEDIVRADAILASNTSSLSITAIAATCKHPERVAGFHFFNPVPLMKVVEVIDGLRSAP
ATGDALAALAKRMGHTAVRCIDMPGFIVNHAGRGMNTEGLRVAQESVAAYADIDAIMREQ
AGFRMGPFELMDLTGLDVSHPVMESVYRQFYDEPRYRPSQITAVRFAGGILGRKTGEGFY
RYPEGQKQVPAETPAPSARPSSVWISRAHDAGHAAAQRLLLDLGITPEAGSKPSADALII
VTPRGLDATACVAAEGLDARRTVALDTLYPFAATKRRTLMTTPATDAAYRDAAHGLLASD
GVPVTVIRDSGGFVAQRIVACIVNIACDIAQQRIATPTDIDLAVTLGLGYPKGPLALGDT
LGTNAILEILQNLYVLYGDPRYRPSPWLLRRARLGMSLLTPDA