Protein Info for ABZR87_RS14535 in Ralstonia sp. UNC404CL21Col

Annotation: 3-isopropylmalate dehydratase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR00171: 3-isopropylmalate dehydratase, small subunit" amino acids 1 to 196 (196 residues), 270.6 bits, see alignment E=3.6e-85 PF00694: Aconitase_C" amino acids 1 to 132 (132 residues), 139 bits, see alignment E=1.8e-44 PF27512: LeuD" amino acids 136 to 172 (37 residues), 53.7 bits, see alignment 2.1e-18 PF27434: LeuD_C" amino acids 185 to 211 (27 residues), 47 bits, see alignment (E = 2e-16)

Best Hits

Swiss-Prot: 99% identical to LEUD_RALSO: 3-isopropylmalate dehydratase small subunit (leuD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01704, 3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC: 4.2.1.33 4.2.1.35] (inferred from 99% identity to rpf:Rpic12D_1820)

MetaCyc: 61% identical to maleate hydratase small subunit (Pseudomonas alcaligenes NCIMB 9867)
Maleate hydratase. [EC: 4.2.1.31]

Predicted SEED Role

"3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 4.2.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.33, 4.2.1.35

Use Curated BLAST to search for 4.2.1.31 or 4.2.1.33 or 4.2.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>ABZR87_RS14535 3-isopropylmalate dehydratase small subunit (Ralstonia sp. UNC404CL21Col)
MEQFTIHTGLVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNLFDEWRYKDVGEPGQDNSK
RPLNPDFVLNQPRYKGASVLLARKNFGCGSSREHAPWALQQYGFRAIIAPSFADIFFNNC
FKNGLLPIVLTESQVDHLFNETQAFTGYQLTVDLDKQVVVTPGGTAYPFDITAFRKYCLL
NGFDDIGLTLRYADQIKAYEAQRLAKMPWLAHKLVG