Protein Info for ABZR87_RS14365 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details PF00892: EamA" amino acids 5 to 135 (131 residues), 72.4 bits, see alignment E=2.1e-24 amino acids 155 to 291 (137 residues), 64 bits, see alignment E=8.5e-22

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpi:Rpic_2100)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>ABZR87_RS14365 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MPIHALFLIAAMALVGSNVGFGKSIVAVMPVMLFALLRFLIAIVCMAPWYKPARMRRVTR
GEWTNLFLQAFFGTFGFTLLMLNGVRLTSALAAGIITSTIPAAVALLSWLVLREKPSGRT
LASVVLAVAGVAILNAYRGGESSGAAPADAAQALLGNALVMGAVLCESIYVILSRRLTQT
LPAIEICAYTHLIGGLLMLPLGLVPLLTFDLSGVPLPIWGLVLWYALSASIFSFWLWMKG
IRHVPAHLAGVFTSVLPIAAATYGIVALEETPGWPHGIALACVVAGILVASWPARPRQPI
QRGRQRGRAADPLDPLDPSLDRE