Protein Info for ABZR87_RS14285 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 108 to 134 (27 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 227 to 255 (29 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details PF12911: OppC_N" amino acids 21 to 76 (56 residues), 49.7 bits, see alignment E=2.7e-17 PF00528: BPD_transp_1" amino acids 124 to 308 (185 residues), 123.2 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 36% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to rpf:Rpic12D_1761)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ABZR87_RS14285 ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MMNTTPQPTTAAAVAAPRKQSPWRRVVSDFLASKTAVFGLVVVVILMLAALAAPWITPQN
PYDLMQLDVLDSRLPPGSPNGLGTFTYWLGTDGQGRDLYSGILYGLRISLGVGIGSAAVA
AVIGTLLGLIAAYAGGRVDSIIMRTVDLLLSFPSVLVAMMILAYLGKSITNVVLTLVLLE
WAYYARTVRGQALVERRREYVEAARSLALPGWRIALRHILPNCLPPLIVVGTLQVARAIT
LEATLSFLGLGVPITEPSLGLLISNGYQYMLSGQYWISFYPGIALLLALVAINLVGDRLR
EVLNPRTQR