Protein Info for ABZR87_RS14280 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 134 to 160 (27 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 243 to 269 (27 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 101 (101 residues), 41.5 bits, see alignment E=1.4e-14 PF00528: BPD_transp_1" amino acids 112 to 319 (208 residues), 139.6 bits, see alignment E=1e-44

Best Hits

Swiss-Prot: 36% identical to Y2551_BRUO2: Putative peptide permease protein BOV_A0351 (BOV_A0351) from Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 99% identity to rpi:Rpic_2083)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ABZR87_RS14280 ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MTGWLIRRIGQALLVVLVMTVIVFIGLHAIGNPVDILIGQDVDQIDRARIIAELGLDKPL
WEQYLAFLNGALHGNLGKSFVYNEPAIQLILQRLPATLELAFSALIIAVVVGVPLGLFAG
LYPRHPVSRLLMTGSVVGFSLPTFWVGLMLIMAFSVSLGWLPASGRGETARLFGIEWSWL
TVDGLRHLVLPAVNLSLFKLSLVLRLTSAGVREVLPQDFVKFARAKGLSPLRVVLAHVLR
NTLIPLVTVLGLELGSTIAFAVVTESIFAWPGAGKLILDSINSLDRPVIVSYLIVVVCLF
VSLNLIVDILYRLLDPRVRAADSAEAA