Protein Info for ABZR87_RS14160 in Ralstonia sp. UNC404CL21Col

Annotation: transglycosylase SLT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01464: SLT" amino acids 111 to 215 (105 residues), 95 bits, see alignment E=2.4e-31 PF01476: LysM" amino acids 336 to 378 (43 residues), 15.4 bits, see alignment 1.4e-06 amino acids 418 to 447 (30 residues), 24.9 bits, see alignment (E = 1.6e-09)

Best Hits

KEGG orthology group: K08307, membrane-bound lytic murein transglycosylase D [EC: 3.2.1.-] (inferred from 98% identity to rpi:Rpic_2038)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>ABZR87_RS14160 transglycosylase SLT domain-containing protein (Ralstonia sp. UNC404CL21Col)
MRSVRLLAATVLSLLLAACATAPGPNADTASTSASTVSGQASAPVVNIDQQPVASLKGPA
KDLWARIRQGFSMPDLQSSAVDDRTDWYAQRPDAFRRMVDRSNRYLYHIVEELERRNMPT
ELALLPFVESAFNPQAVSSAKAAGMWQFIPSTGRTYNLKQNVFQDERRDVLASTDAALDY
LSKLHDQFGDWQLALAAYNWGEGAVARAIARNQAAGLSTDYVNLNMPAETRMYVPKLQAV
KNIIANPERYGVTLPEIPNHPYFVTVTTSRDIDVTLAAKLANLPMDEFKALNPSFNRPVI
LGASNPQILLPYDNAETFQYNLNTYRGGLSSWTAVTVGNRERVEALAARLKVDPDTIREI
NRIPKGMRLKAGSTVVVPRVDGAQENAPDISPELAENATMAVEPDMPDLRKVVVRAGKRD
TVAGLSRRYGVSVAQIRAWNQLPGDAIPKGHSVVLMLPQARGGSRGGHVRVVRVSAATSR
AATATPRVPTAKVAGKPVVKAKPVATSSSSVKRKKR