Protein Info for ABZR87_RS14095 in Ralstonia sp. UNC404CL21Col

Annotation: phosphate ABC transporter permease PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 22 to 51 (30 residues), see Phobius details amino acids 78 to 105 (28 residues), see Phobius details amino acids 119 to 144 (26 residues), see Phobius details amino acids 164 to 190 (27 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 23 to 316 (294 residues), 303.6 bits, see alignment E=6.1e-95 PF00528: BPD_transp_1" amino acids 101 to 313 (213 residues), 55.4 bits, see alignment E=3.3e-19

Best Hits

Swiss-Prot: 74% identical to PSTC_ECOLI: Phosphate transport system permease protein PstC (pstC) from Escherichia coli (strain K12)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 98% identity to rpi:Rpic_2025)

MetaCyc: 74% identical to phosphate ABC transporter membrane subunit PstC (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>ABZR87_RS14095 phosphate ABC transporter permease PstC (Ralstonia sp. UNC404CL21Col)
MATLSDSSGASRMRAPSRLGDLVFGGLTRLAAIVTLLLLGGIIISLIISSWPTIQKFGLS
FLWNSEWDPPSDIYGALVPVYGTLVTSLIALIIAVPVSFGIALFLTELSPAWLRRPLGTA
IELLAAVPSIVYGMWGLLVFAPIFGEYFQKPLAATVGKIPVIGALFQGAPIGIGLLCAGV
ILAIMIIPYISAVMRDVFEITPTLLKESAYGVGCTTWEVMWNVVLPYTKAGVIGGVMLGL
GRALGETMAVTFVIGNTNLLSDASLFSPGNSITSALANEFAEAGQGLHTAALMELGLILF
VITFIVLAASKLLLLRLQKSEGQK