Protein Info for ABZR87_RS14070 in Ralstonia sp. UNC404CL21Col

Annotation: phosphate regulon sensor histidine kinase PhoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details PF11808: PhoR" amino acids 9 to 89 (81 residues), 55.7 bits, see alignment E=1.4e-18 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 94 to 424 (331 residues), 445.6 bits, see alignment E=4.9e-138 PF13188: PAS_8" amino acids 99 to 152 (54 residues), 29.5 bits, see alignment 1.3e-10 PF00989: PAS" amino acids 102 to 153 (52 residues), 23.5 bits, see alignment 1.2e-08 PF00512: HisKA" amino acids 206 to 271 (66 residues), 71.9 bits, see alignment E=8.9e-24 PF02518: HATPase_c" amino acids 318 to 427 (110 residues), 99.1 bits, see alignment E=5.2e-32

Best Hits

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 98% identity to rpi:Rpic_2020)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>ABZR87_RS14070 phosphate regulon sensor histidine kinase PhoR (Ralstonia sp. UNC404CL21Col)
MNVFWTRFAVFAALMGIVTACLYFFVNHVVALAVLSAMLLAMLLYYIYQIQRLWRVLDSP
AYGEIPSALGLWGEVYYRLHRLMKGWRTQVLQVEQQHSRFIQAIQASPNGVLMLDGEDQI
EWCNAVAEEHFGLSAKRDLRQRITHLIRRPEFVRYLARGEFEEPLTMHDVGPHKQSIVSA
QILPYGEDRKLLVSQDITKLENTEAMRRDFVANVSHELKTPLTVLSGFLETVRDIPLPEE
DKRRYLDMMHTQAMRMQHLVEDLLALATLEGNSEPPSVAPVPMQRMMLQLQHDIEALSAG
RHTVSMTCDPAVSVCGAELELLSAFSNLASNAVRYTPDGGSIRLDWGVRDGHAVYSVTDT
GIGIAPEHIPRLTERFYRVDRSRSRDTGGTGLGLAIVKHVLSRHGGELQVTSEHGKGSTF
RAVFPPERTVVRSATVTDERVA