Protein Info for ABZR87_RS14020 in Ralstonia sp. UNC404CL21Col

Annotation: LysE/ArgO family amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details PF01810: LysE" amino acids 22 to 207 (186 residues), 126.4 bits, see alignment E=5e-41

Best Hits

Swiss-Prot: 41% identical to ARGO_YERE8: Arginine exporter protein ArgO (argO) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 98% identity to rpi:Rpic_2011)

Predicted SEED Role

"Arginine exporter protein ArgO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>ABZR87_RS14020 LysE/ArgO family amino acid transporter (Ralstonia sp. UNC404CL21Col)
MTTSIATSSSVFLQGLALSFGLIVAIGAQNAFVLRQGLRREHVGSVVLFCAMADAVLILA
GVLGMAQALGERPSLARFLALAGAAFLLLYGVQALRRARHSNQLRASAGGDGLSRRAALA
QAAAFTLLNPHVYLDTVLLVGSIGAQQASALRGWFVAGAGSASLFWFVSLGFGARWLAPW
FARPKAWQVLDGLIGVTMLVLSALLLRHALGGF