Protein Info for ABZR87_RS13910 in Ralstonia sp. UNC404CL21Col

Annotation: type VI secretion system tip protein TssI/VgrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 866 TIGR03361: type VI secretion system Vgr family protein" amino acids 28 to 530 (503 residues), 431.2 bits, see alignment E=5.1e-133 TIGR01646: Rhs element Vgr protein" amino acids 36 to 532 (497 residues), 384.2 bits, see alignment E=1e-118 PF05954: Phage_GPD" amino acids 41 to 360 (320 residues), 288.4 bits, see alignment E=1.3e-89 PF04717: Phage_base_V" amino acids 421 to 481 (61 residues), 38.1 bits, see alignment 3.2e-13 PF13296: T6SS_Vgr" amino acids 505 to 612 (108 residues), 125 bits, see alignment E=2.8e-40 PF10106: DUF2345" amino acids 644 to 791 (148 residues), 134.3 bits, see alignment E=6.4e-43

Best Hits

KEGG orthology group: None (inferred from 80% identity to rpf:Rpic12D_1679)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (866 amino acids)

>ABZR87_RS13910 type VI secretion system tip protein TssI/VgrG (Ralstonia sp. UNC404CL21Col)
MGAAEQVANLMGSHRTVKATSAAIPKLLGQPQLEFVRVSGREALSELFTYTVDLRPVSLA
AEQAMLEADLDDAIGLEMTLTIELDGIGTGLMGGVGSGERQITGLITAVEQIGGVADNRL
YRFTLRPWLWLATQTADYKAFQNKSVIDILDEVLADYTFSVDKRLDESAFPKLEWEVQHG
ETDFAFLQRLTEEWGITYFFEHDGGHHRLVLVSESGAWRKFPSAAYHTLPIYPQGFKVDE
EHLTRFQPINRLRTGKITLKDYDPRQPKADLTTGDSLPRDTRFSEFERYEYEPGSYTNRD
LGNQRARIRMEERRAKGRRVRGAGALRGIAAGCTYQIAKHDKDDLNREILIVSTEFQLED
VAIQSGSAQRYACHVRFEAHPTDEVFRPPLTTAKPRVRGIQRAVVTGPENQEVWTNDFGC
VKVQFEWDRYGQYNENSSPWIRVANGWSGDQFGAMHVPRIGQEVLVDYLNGDPNTPIIIG
RVPNQLNLPPWALPGQHALSGIASKELFGKRRNHLVMDDTQGQIQAQLSSDHQTSQLNLG
YLTGVPGNPGRKDPRGEGFDLRTDGQGAIRGAKGLFLTTEGQVAAVGGHLDRQEFIRCME
AALEAAKSLGDYSSQHEALKTDADPQSTLTKAIEEWDAGANNHQDKPGQGGQPVLGAYAP
AGIALATPKSLTSYAGQHIDTVSKLNQQQTAGQQYLVNAGTGISLFAHSGEWKGIAHQGQ
LVLQAQQKSITANARQDVVVTATDGSILLNSKTGITLMSGNAGIRIADGKVEAFGPTLIH
LHTGNFDVPGPEGVNGALPQFDSAKAERGFELVRAHDKQPIPNAPYTLAKADGGVEQGIA
SNGTTEQSVTQTIEQMTAAFNAPKLY