Protein Info for ABZR87_RS13705 in Ralstonia sp. UNC404CL21Col

Annotation: integration host factor subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF18291: HU-HIG" amino acids 30 to 125 (96 residues), 26.5 bits, see alignment E=5.7e-10 TIGR00987: integration host factor, alpha subunit" amino acids 37 to 129 (93 residues), 144.4 bits, see alignment E=5.7e-47 PF00216: Bac_DNA_binding" amino acids 38 to 126 (89 residues), 103.2 bits, see alignment E=7.5e-34

Best Hits

KEGG orthology group: K04764, integration host factor subunit alpha (inferred from 99% identity to rpf:Rpic12D_1641)

Predicted SEED Role

"Integration host factor alpha subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>ABZR87_RS13705 integration host factor subunit alpha (Ralstonia sp. UNC404CL21Col)
MNDQHAPALAASLGDSLGSSSTALGDARDARAQDVPTLTKAELAEMLFEQVGLNKRESKD
MVEAFFDVIREALEQGDSVKLSGFGNFQLRDKPQRPGRNPKTGEIIPITARRVVTFHASQ
KLKALVEERVEPLPVDVA