Protein Info for ABZR87_RS13320 in Ralstonia sp. UNC404CL21Col

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 26 to 269 (244 residues), 299 bits, see alignment E=1.2e-93 PF09976: TPR_21" amino acids 28 to 119 (92 residues), 26.2 bits, see alignment E=1.9e-09 PF13512: TPR_18" amino acids 50 to 189 (140 residues), 153.6 bits, see alignment E=1.2e-48 PF13525: YfiO" amino acids 54 to 258 (205 residues), 222.6 bits, see alignment E=1.4e-69 PF13432: TPR_16" amino acids 59 to 125 (67 residues), 26.3 bits, see alignment E=2.6e-09 amino acids 98 to 140 (43 residues), 18.3 bits, see alignment 8.1e-07 PF13174: TPR_6" amino acids 67 to 85 (19 residues), 14.9 bits, see alignment (E = 1e-05)

Best Hits

Swiss-Prot: 48% identical to BAMD_NEIMA: Outer membrane protein assembly factor BamD (bamD) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K05807, putative lipoprotein (inferred from 100% identity to rpf:Rpic12D_1592)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>ABZR87_RS13320 outer membrane protein assembly factor BamD (Ralstonia sp. UNC404CL21Col)
MSVTSVKQARIVSRVGNRIRAQIGAVLVAGVACLAISACGILPEQQDETAGWSANKLYSE
AKDSLDGGDYAKAVKYYEKLESRYPFGQYAQQAQIETAYANYKDGETAAALAAVDRFIQL
HPNHPSVDYAYYLKGLINFNDNLGWLGRFSNQDLSERDPKAARAAYDAFKTLITRFPNSK
YTPDATQRMQYIVNAMAEHEVGAARYYYRRGAYLAAVNRAQDAIKDYDRAPAVEEALYIM
MKSYEALGMKDMRDDTERIIKQNYPKSDFLAYGQRKKDKPWYQWW