Protein Info for ABZR87_RS13280 in Ralstonia sp. UNC404CL21Col

Annotation: tRNA-dihydrouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01207: Dus
  • amino acids 5 to 304 (300 residues), 230.9 bits, E=1e-72

Best Hits

Swiss-Prot: 85% identical to DUSC_RALSO: tRNA-dihydrouridine(16) synthase (dusC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K05541, tRNA-dihydrouridine synthase C [EC: 1.-.-.-] (inferred from 99% identity to rpf:Rpic12D_1583)

Predicted SEED Role

"tRNA-dihydrouridine synthase C (EC 1.-.-.-)" in subsystem Murein hydrolase regulation and cell death (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (326 amino acids)

>ABZR87_RS13280 tRNA-dihydrouridine synthase (Ralstonia sp. UNC404CL21Col)
MSRLLLAPMEGVADYVMRDVLTQAGGYDGCVSEFVRVTGSLLPARTYERETPEIRNGGYT
ASGTPMTIQLLGSDPEWLARNAAYAATLTPHGIDLNFGCPAKVVNRHGGGAMLLATPEVL
YDIVHAVRAAVPANISVTAKMRLGVSDTSRAIDCATALAEGGAESLVVHARTRDHGYRPP
AHWDWIARIADAVSIPVTANGEVWTVADWERCRAVSGCSDVMIGRGAVSDPFLAQRIRGQ
MDEAPSAAEWPIVLGYLADYLKKLHARISAKHEHGRVKLWLSYLKRTWPQAAELHDAIRR
LQDALEIERVIEQMQLRLGRPNAANG