Protein Info for ABZR87_RS13230 in Ralstonia sp. UNC404CL21Col

Annotation: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02542: YgbB
  • amino acids 6 to 159 (154 residues), 233.5 bits, E=6.8e-74
• TIGR00151: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  • amino acids 7 to 160 (154 residues), 221.2 bits, E=3.3e-70

Best Hits

Swiss-Prot: 99% identical to ISPF_RALPJ: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01770, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 4.6.1.12] (inferred from 99% identity to rpf:Rpic12D_1573)

MetaCyc: 60% identical to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. [EC: 4.6.1.12]

Predicted SEED Role

"2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 4.6.1.12)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• isoprene biosynthesis I (7/10 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.12

Protein Sequence (168 amino acids)

>ABZR87_RS13230 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Ralstonia sp. UNC404CL21Col)
MNWMDIRIGQGYDVHALVEGRKLILGGVEIPHTRGLLGHSDADALLHAITDALFGAAGLG
DIGRHFPDTDPAFAGADSRVLLREAVRRVHKAGYAIGNVDATVIAQKPKLAPHVPGMVAN
LAEDLGIAPERCNVKAKTNEKLGFEGKEEGIVAQAVVLIYRAEAAEQD