Protein Info for ABZR87_RS13225 in Ralstonia sp. UNC404CL21Col

Annotation: carboxymuconolactone decarboxylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF02627: CMD" amino acids 95 to 172 (78 residues), 50.4 bits, see alignment E=9.2e-18 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 111 to 161 (51 residues), 28.8 bits, see alignment E=3.3e-11

Best Hits

Swiss-Prot: 42% identical to AHPD_BRASB: Alkyl hydroperoxide reductase AhpD (ahpD) from Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)

KEGG orthology group: K04756, alkyl hydroperoxide reductase subunit D (inferred from 97% identity to rpf:Rpic12D_1572)

Predicted SEED Role

"Alkylhydroperoxidase protein D" in subsystem Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>ABZR87_RS13225 carboxymuconolactone decarboxylase family protein (Ralstonia sp. UNC404CL21Col)
MEFLQTLKSRIPDYAKDIRLNLDGTIARSSLEGNDPVGVALAAAFAAKSKVLTDAIRNAG
VLSPEEVNGALTAAALMGMNNVWYPYVEMADDSDLAQQKAELRMNAYANNGGVDKRRFEM
YALAASIIGKCHFCIKSHYDLLKNHQGMSAQQLRDVGRIAAVINAAAQVIAAE