Protein Info for ABZR87_RS13215 in Ralstonia sp. UNC404CL21Col

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details PF16524: RisS_PPD" amino acids 52 to 158 (107 residues), 130.7 bits, see alignment E=5.3e-42 PF00672: HAMP" amino acids 184 to 235 (52 residues), 40 bits, see alignment 8.2e-14 PF00512: HisKA" amino acids 243 to 296 (54 residues), 44 bits, see alignment 3.7e-15 PF02518: HATPase_c" amino acids 341 to 438 (98 residues), 64.8 bits, see alignment E=1.9e-21

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 99% identity to rpf:Rpic12D_1570)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>ABZR87_RS13215 ATP-binding protein (Ralstonia sp. UNC404CL21Col)
MRIPRPAALRRLLISVFGSLFWRTFMLIALLIAISLGVWFQSFRIFEREPRAQQIAMQVV
SVVKLTRAALLYSDPSRRRFLLLDLVQNEGIKVYPREKEDEYREPHTNPYLTQLVQQEIR
NRLGADAVIATAVNDIPGVWVSFQIEGDDYWVAISPDRFEHVPGLQWLWWSMAALVLSVL
GAAFITSRVNQPLKRLADTARAISAGEDPKALPEGGGTEVAQANHSFNQMVRDLKQLEAD
RAVMLAGISHDLRTPLTRLRLETEMSPVDEQTRELMVADIEQMDAIIGQFLDYARPSGEM
LEDVDLTELVRDTAPVYSAHDDIDLTLKLAPEAIARCNRMETQRILDNLIENARRYGKTP
GTNRAEITVSTFLQGNEVVLCVADRGAGVPTDQLALLTRPFYRLESARSEAKGAGLGMSI
VNRILQRSGGRLALENRTPPETGLLVSACYSRA