Protein Info for ABZR87_RS12990 in Ralstonia sp. UNC404CL21Col

Annotation: phage tail protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF06891: P2_Phage_GpR" amino acids 1 to 130 (130 residues), 175.9 bits, see alignment E=1.8e-56

Best Hits

Swiss-Prot: 52% identical to VPR_BPP2: Tail completion protein R (R) from Escherichia phage P2

KEGG orthology group: None (inferred from 82% identity to rso:RSc1929)

Predicted SEED Role

"Phage tail protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>ABZR87_RS12990 phage tail protein (Ralstonia sp. UNC404CL21Col)
MMKPNSLREALTAAVPYLAAHPDALHVFVDEGNVVGTGARSLGFEYRYTLTLIVTDYPDS
SDTVVVPVLAWLRTNQPDAFTNPDKREDAFKFEAEILNHSTADISIKLKLTERVTVKVDG
KGYQVQHHPEPVNEYDDPATWRPA