Protein Info for ABZR87_RS12895 in Ralstonia sp. UNC404CL21Col

Annotation: ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 23 to 256 (234 residues), 346.7 bits, see alignment E=2.6e-108 PF00116: COX2" amino acids 167 to 238 (72 residues), 35.6 bits, see alignment E=8e-13 PF06481: COX_ARM" amino acids 256 to 300 (45 residues), 67.4 bits, see alignment 7.7e-23

Best Hits

Swiss-Prot: 50% identical to QOX2_ACEAC: Ubiquinol oxidase subunit 2 (cyaB) from Acetobacter aceti

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 99% identity to rpf:Rpic12D_1548)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>ABZR87_RS12895 ubiquinol oxidase subunit II (Ralstonia sp. UNC404CL21Col)
MPRFNAVVTPLGITGRSLWRGAAIALLVTLTGCSHAVLLSPAGDMAVRQRDLIIIATCLM
LLIIVPVIVLTLLFAWRYRESAENAHYNPDWDHSTVLELAIWAAPLLIIITLGAITWVST
HQLDPYRPLTRLDQDRPVPAETKPLTVEVVAMDWKWLFVYPEQGIATVNELAAPVDRPIA
FRITATTVMNAFFVPSLAGMVYAMPGMETKLHAVINRPGVYDGLSSNYSGAGFSHMRFKF
HGLSNDEFDRWVQQVKSSGTSLSKDTYLKLAKPSESEPVQRYASVAPDLYDRILNRCVDG
QACLADTMASNRNVKRFDPSAEICTASNTVDVMPMFAPDAAINDGRRLLR