Protein Info for ABZR87_RS12880 in Ralstonia sp. UNC404CL21Col

Annotation: cytochrome o ubiquinol oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details TIGR02847: cytochrome o ubiquinol oxidase subunit IV" amino acids 28 to 123 (96 residues), 109.9 bits, see alignment E=3.4e-36 PF03626: COX4_pro" amino acids 35 to 107 (73 residues), 59.9 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 98% identity to rpf:Rpic12D_1545)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>ABZR87_RS12880 cytochrome o ubiquinol oxidase subunit IV (Ralstonia sp. UNC404CL21Col)
MSAQDQTMNGHGHGHEGHHHEEEIGPHATLGGYLTGFVLSVFLTAIPFWLVMANVFDRSS
ITAVTILLIGAVQIVVHMIFFLHMNAKSEGGWNMLSLMFTLVLVVITLSGSLWVMYHLNT
NMMPHMRPAQTTPAVLPARTQ