Protein Info for ABZR87_RS12835 in Ralstonia sp. UNC404CL21Col

Annotation: SidA/IucD/PvdA family monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13434: Lys_Orn_oxgnase" amino acids 32 to 368 (337 residues), 384 bits, see alignment E=3.3e-119

Best Hits

Swiss-Prot: 59% identical to ALCA_BORBR: Alcaligin biosynthesis enzyme (alcA) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03897, lysine N6-hydroxylase [EC: 1.14.13.59] (inferred from 67% identity to bge:BC1002_6812)

MetaCyc: 59% identical to putrescine N-hydroxylase (Bordetella bronchiseptica)
1.14.13.M63 [EC: 1.14.13.M63]

Predicted SEED Role

"Siderophore [Alcaligin] biosynthetic enzyme (EC 1.14.13.59) @ Siderophore biosynthesis protein, monooxygenase" (EC 1.14.13.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.59 or 1.14.13.M63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>ABZR87_RS12835 SidA/IucD/PvdA family monooxygenase (Ralstonia sp. UNC404CL21Col)
MRCASPVAFLVLSFGKCSLCKSGGSSVMKSDVYDFIAIGLGPFNLSLACLAEPIESLNGL
FLERAEEFNWHPGMLIDKTTLQNPFLADLVSLADPQSRFSFLNYCKQEGKIYSYYIRENF
YLSRAEYNRYCKWVIAQLRSVHFHHDVDALAYDAQRGCYVVTGFRGAEREPFVLRARKLV
LGVGSSPSFPACVPRDGHRYLHTADYIDVRDALREKRSITIVGSGQSAAEVYYDLLKESD
KHDYSLVWITRSPRFFQMENTKLTLEMISPDYIDYFFNLPDGRKESILRKQDSLYKGVNA
SLINQIYDLLDDKRKTGALRTHLITNCELQACRHDAATGTYEIEFQQLDSGARYAHRTEG
LVLATGYEQNIPAFIDGIRHRLRWDAKGRYQLSRNYAADFNGNEVYVQNAGLHTHGLTNP
DLGMSCYRNSCIIRELTGVEHYKIERRIAIQDFAIPSTPDFIPLAARESAKEATRDRVPE
MAEETAGVAA