Protein Info for ABZR87_RS12830 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 263 (256 residues), 71.7 bits, see alignment E=2.7e-24 amino acids 280 to 400 (121 residues), 35.1 bits, see alignment E=3.8e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>ABZR87_RS12830 MFS transporter (Ralstonia sp. UNC404CL21Col)
MTLRVYIILMTTFAVISDAILIPFYPQFFASRYGLDSPVHVGAYVAAISIAVMCTLPVWA
RVAKRVEPLHLLVYTQCAAGTFSLLSDWAPDVVTYWVLSMLMFMCKSSYLLMYPYMMRLT
PKEQHAATVGILSVVVHFGAIFGAVVGGFVLQTWGPRASIVAMAAGDFFQMAVCLYLIRS
GKIVRVNSGEHAEAAAAEAPRTRWRDRLPILRLALVMLVFDFSAYLIRSFFSVYWQQVSG
HDSEFVSGMVFAIPGAMAILALRLHARIRARGGKLPDHTLGNLLLGAAGLLLQAAPNPVL
IVIGRVLYGWALFQIIVKLDVNLFRLSTPQRYAHDYSITNFFQNLGVLLSSFAAGAIVNR
YGLHVPFLLAACGFVLTALLDRLILNVPSATHAGEAGRAGEPINVEEPAHAN