Protein Info for ABZR87_RS12815 in Ralstonia sp. UNC404CL21Col

Annotation: siderophore ferric iron reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR03950: siderophore ferric iron reductase, AHA_1954 family" amino acids 37 to 255 (219 residues), 167.6 bits, see alignment E=1.9e-53 PF11575: FhuF_C" amino acids 235 to 255 (21 residues), 25.7 bits, see alignment (E = 4.1e-10)

Best Hits

KEGG orthology group: None (inferred from 49% identity to bbr:BB3896)

Predicted SEED Role

"Putative iron reductase in siderophore [Alcaligin] cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>ABZR87_RS12815 siderophore ferric iron reductase (Ralstonia sp. UNC404CL21Col)
MTDGMRAFVEDASGPGFATAVAWRPSPAPDLARVWAAVQRVLPSLRGEQGGVAPAGALRL
GDDDALRALCDHWARAYPEAGAHYLALRCWGLAIWQPIYLCVIAVHLDAPVPSLSGLAQP
MKNGFPSGLHLPAQVPVEGTFAARREVAATELRAFCAAMRRALKPMVSLHDRAADRLQAE
CVLGALMAVRPHVPLSDAALVAAGEDWLAHLGISGGCGFFAYRARDGTPALALDRKVCCH
HFRRHDGEKCSTCPKLSLDARIARLVAEAG