Protein Info for ABZR87_RS12805 in Ralstonia sp. UNC404CL21Col

Annotation: bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 PF05430: Methyltransf_30" amino acids 113 to 232 (120 residues), 150.1 bits, see alignment E=2.9e-48 TIGR03197: tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain" amino acids 252 to 652 (401 residues), 410.2 bits, see alignment E=4.9e-127 PF01266: DAO" amino acids 253 to 623 (371 residues), 142.2 bits, see alignment E=3.2e-45

Best Hits

Swiss-Prot: 81% identical to MNMC_RALSO: tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC (mnmC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 88% identity to rpi:Rpic_1871)

Predicted SEED Role

"5-methylaminomethyl-2-thiouridine-forming enzyme mnmC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (672 amino acids)

>ABZR87_RS12805 bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC (Ralstonia sp. UNC404CL21Col)
MPRGLVLATPQLTSDGTPFSAQYDDVYHSSEGGLAQAHHVFLGGNGLPGAWQGKRAFTIV
ETGFGQGLNFLATWAAWRDDPQRCARLDFVSIEKHPFDRAGLSVVHPASGALAPLAEMLR
RSWPVPVPGVHRLTFDDGRVTLTLLLGDAMETLPQLSCAADAFYLDGFSPAKNPDLWQPR
VFKQLARVARAGATLATYTAAGFVRRGLQEAGFEVRKAPGFGSKRDMTVAQFPTHWRTRR
GPVEAPVWGQRHAIVLGAGLAGCPIAERLASRGWRVTLVDENDGHARGTSAHRAAAMHPH
VSIDDSVLSRLSRAGNLLARRHWDALDCAGFATGFQCTGVLQLAEDADDATEQQRIVQTL
GYPTDYIDWLNVEEAAQRVGASVPQGGWWFAQAGWVAPPDICRANLAAAGTAIDTRWNTH
VGSLRQDGDQWQALDAQGAVIASAPVIVLANSLGAARLAPLNSASLKPVRGQLTDVPVAG
FEAGLAWPKAVVCGNGYLLPAEPGARSVRIGSSFQPGESDLTERVADHAANLRRLAGLQP
QQSGALAKLDVAQLHGYVGVRCVSANRLPLIGPLVDEAAATAPGFRLRGPHAQLPRLAGL
YAALAYGSRGLTWSVLGAELLAAQIDGGPLPLESDLVAALDPGRFVLRALQHGHHQGQGA
TPPENEAAEPLD