Protein Info for ABZR87_RS12740 in Ralstonia sp. UNC404CL21Col

Annotation: bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 266 to 284 (19 residues), see Phobius details TIGR00197: YjeF family N-terminal domain" amino acids 37 to 227 (191 residues), 108.8 bits, see alignment E=3e-35 PF03853: YjeF_N" amino acids 46 to 209 (164 residues), 138.3 bits, see alignment E=2.6e-44 TIGR00196: YjeF family C-terminal domain" amino acids 252 to 514 (263 residues), 199 bits, see alignment E=9.7e-63 PF01256: Carb_kinase" amino acids 269 to 500 (232 residues), 173.7 bits, see alignment E=4.8e-55

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpi:Rpic_1860)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>ABZR87_RS12740 bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase (Ralstonia sp. UNC404CL21Col)
MSSHPTWREILIDGALAAHHGADLLFGTAGIRALEAAAYRTLEPFTLMARAGDAAADWLQ
TRAPHGHVLLVAGPGNNGGDALVAATVLHLAGRAVTVWLAADPAQLPDDARRAWTEACAA
NVPIEQLHTPASVPAATSAIVDGLFGVGLARPLTGLHAALVDTINASGLPVYALDIPSGL
NGDTGQPPAPDSPVIQARATITFLAIKPGLLTGDGRDATGDIALADLQAAQPAYDGVVEA
DAFVNTPSRWLAHVPRRRHNGHKGTYGSVAIVGGAAGMVGAPLLSARGALYLGAGKVHVA
SLAADAPRVDPAQPELMLHSWGALDLGGMQALAVGPGMGTGKESEAALEHLLDRMLSAHT
PAVFDADALNLFAKTPALLARLTQLARSGVPLVLTPHPLEAARLLQTDARAVQHDRLAAA
QALVNRTGAVVVLKGSGTIVAAPGIAPAINPTGNGGLATGGTGDVLTGMIGALLAQGMGA
REAALAGVWLHGRAADDLVQAGVGPIGLHASELCAPARRALNALLASDVRR