Protein Info for ABZR87_RS12635 in Ralstonia sp. UNC404CL21Col

Annotation: peptide-methionine (R)-S-oxide reductase MsrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 TIGR00357: methionine-R-sulfoxide reductase" amino acids 4 to 126 (123 residues), 202.4 bits, see alignment E=1.3e-64 PF01641: SelR" amino acids 9 to 126 (118 residues), 190.3 bits, see alignment E=4.9e-61

Best Hits

Swiss-Prot: 91% identical to MSRB_RALSO: Peptide methionine sulfoxide reductase MsrB (msrB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 98% identity to rpi:Rpic_1457)

MetaCyc: 53% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>ABZR87_RS12635 peptide-methionine (R)-S-oxide reductase MsrB (Ralstonia sp. UNC404CL21Col)
MTVKKSDAEWRDQLSDIEYRVTREAATERPFTGKYWDHWERGVYNCVCCGTPLFESSTKF
DAGCGWPSYFQPINGEVIAEKTDRSHGMLRIEVQCKNCGAHLGHVFEDGPAPTGLRYCIN
SAALKFGD