Protein Info for ABZR87_RS12550 in Ralstonia sp. UNC404CL21Col

Annotation: NADP-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 121 to 136 (16 residues), see Phobius details PF16884: ADH_N_2" amino acids 7 to 113 (107 residues), 148.8 bits, see alignment E=7.4e-48 PF00107: ADH_zinc_N" amino acids 158 to 292 (135 residues), 77.2 bits, see alignment E=1.7e-25 PF13602: ADH_zinc_N_2" amino acids 191 to 330 (140 residues), 34 bits, see alignment E=8.1e-12

Best Hits

Swiss-Prot: 41% identical to PTGR2_RAT: Prostaglandin reductase 2 (Ptgr2) from Rattus norvegicus

KEGG orthology group: K07119, (no description) (inferred from 98% identity to rpi:Rpic_1440)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>ABZR87_RS12550 NADP-dependent oxidoreductase (Ralstonia sp. UNC404CL21Col)
MSKTYQRIVLASRPQGAVTPDNFRLETVDLPELQDGQVLVRNHFLSLDPYMRGRMNDSKS
YAQPQPLDEVMIGGTVGVVEASRNPSFAVGDAVVGMFGWQEVGVSDGRGIQKVDTRHIPL
SAYLGSVGMPGVTAWYGLNKIMHPKPGQTVAVSAASGAVGSVVGQLAKLKGCRVVGFAGG
KDKCDYVVNELGFDACIDYKAAKDPKELYKMLKEATPDGIDSYFENVGGAILDAVLSRMN
AFGRIAMCGMIAGYDGQPLPLQNPQLILVSRLTIEGFIVSEHMDVWPEALRELGGFVAQG
KLKFRESVAQGLASAPEAFIGLLKGKNFGKQLVKLV