Protein Info for ABZR87_RS12515 in Ralstonia sp. UNC404CL21Col

Annotation: thioesterase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family
  • amino acids 11 to 127 (117 residues), 104.6 bits, E=2e-34
• PF13279: 4HBT_2
  • amino acids 14 to 134 (121 residues), 51.9 bits, E=1e-17
• PF03061: 4HBT
  • amino acids 24 to 108 (85 residues), 57.6 bits, E=1.3e-19

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 93% identity to rpf:Rpic12D_1474)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (145 amino acids)

>ABZR87_RS12515 thioesterase family protein (Ralstonia sp. UNC404CL21Col)
MAIEDFRHSTPLRVRWAEVDAQSIVFNGHYLLYADVCITEYWRSIGVRYPVDVVDTFGVD
FYVVKSTLEYHASARFDDELDLRCRVARLGRSSIRFIIEMYRADEHLVSGEVIYVCADPA
TQTSAPIPDTLRERILNFEVLKPEV