Protein Info for ABZR87_RS12455 in Ralstonia sp. UNC404CL21Col

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF12796: Ank_2" amino acids 38 to 127 (90 residues), 41.2 bits, see alignment E=5.3e-14 amino acids 72 to 158 (87 residues), 65.9 bits, see alignment E=1e-21 amino acids 126 to 193 (68 residues), 63.3 bits, see alignment E=6.4e-21 amino acids 160 to 212 (53 residues), 27.5 bits, see alignment E=9.9e-10 PF13637: Ank_4" amino acids 66 to 118 (53 residues), 23.3 bits, see alignment E=1.7e-08 amino acids 112 to 150 (39 residues), 25.1 bits, see alignment 4.4e-09 amino acids 164 to 203 (40 residues), 23.5 bits, see alignment 1.4e-08 PF13606: Ank_3" amino acids 130 to 157 (28 residues), 26.9 bits, see alignment (E = 9.8e-10) PF00023: Ank" amino acids 130 to 158 (29 residues), 32.9 bits, see alignment (E = 1.3e-11) amino acids 165 to 193 (29 residues), 30.6 bits, see alignment (E = 7.1e-11)

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 98% identity to rpi:Rpic_1421)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>ABZR87_RS12455 ankyrin repeat domain-containing protein (Ralstonia sp. UNC404CL21Col)
MRYRDNLKQAMNKIALAGALTMALSGVALATPQDDLRNAVEYNRPALVQKYVAQGVDPNL
KTRDGTPLLVDALKEKNIEVAEALIRAKNIDFERTNAAGENALMMAAYQGLLPMVKLMVE
TYDVEVNKTGWTALHYAATNGYDDIVKYLLDHAAYIDAESPNATTPLMMAAMGGHITTVK
LLLDEGADMNLRNQQKMDVIDFAKRYHQDEIAAGLESRRRKLAEQSGKPAAAPAPAAAVS
QPAKPAAPDVPTPMPPAKRDAAAPSPAGQDTIGTPTNMLFDSNR