Protein Info for ABZR87_RS12450 in Ralstonia sp. UNC404CL21Col

Annotation: ergothioneine biosynthesis protein EgtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 17 to 431 (415 residues), 572.6 bits, see alignment E=3.2e-176 PF12867: DinB_2" amino acids 24 to 142 (119 residues), 46.5 bits, see alignment E=5.3e-16 PF03781: FGE-sulfatase" amino acids 185 to 328 (144 residues), 98.7 bits, see alignment E=4.6e-32 amino acids 355 to 432 (78 residues), 37.5 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_1461)

Predicted SEED Role

"Serine/threonine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>ABZR87_RS12450 ergothioneine biosynthesis protein EgtB (Ralstonia sp. UNC404CL21Col)
MRVSPVLDVPTTALPALMQHYGVVRAQSLALAAPLSDADATVQSMDDASPAKWHLAHTTW
FFEEFILGPNVPGYRSPDARYRYLFNSYYETVGARHPRPRRGMLTRPTLDEVRAYRAHVD
AAMQRLLAGGVSDDLARLVTLGLHHEQQHQELLLTDLLHLFAQNPLCPAYAEAPAARVHA
APAQPGWVSFQGGAVQIGKTETGADTDFMFDCEGPRHTVWLEPYALATHPVTNREWLAFM
QDGGYRQPTLWLSDGWAWVQREAIDAPLYWRAGMDEAEGWQQMSLQGLQPVDLDAPVTHV
SFYEADAYARWAGARLPTEAEWEHAAEGLPVQGNFAGRGALRPLPDHGIAEAGSLRQLFG
DVWEWTASPYGPYPGFEPAEGAVGEYNGKFMCSQMVLRGGSCVSPEGHLRATYRNFFYPH
QRWQFTGVRLARRA