Protein Info for ABZR87_RS12435 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 68 to 94 (27 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 204 to 229 (26 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 270 (186 residues), 57.7 bits, see alignment E=6.7e-20

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to rpf:Rpic12D_1458)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>ABZR87_RS12435 ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MSTVTRSTLPDDAVLPARWRVALLAPAVALFCAFWLLPMAALLRVSGSEGLVATYTAALT
TSRYLGSLFSTVVLSAAVTLATLILSTIAGLFLVRHNVPGKRMITAMLTFPLAFPGVVVG
FMVILLAGRQGLLGDVTHKLVGEKWVFAYSIGGLFLGYLYFSIPRVVLTVMAAAEKLDRS
LEEAARSLGASSWQVTRDVLVPGLAPALIASGAICFATSMGAFGTAFTLATDIDVLPMTI
YTEFTLNAGIAMAAALSVVLGVVTWLVLAIARTASGSPTGAAA