Protein Info for ABZR87_RS12400 in Ralstonia sp. UNC404CL21Col

Annotation: M20 aminoacylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 TIGR01891: amidohydrolase" amino acids 28 to 389 (362 residues), 330.4 bits, see alignment E=7.6e-103 PF01546: Peptidase_M20" amino acids 86 to 398 (313 residues), 160.9 bits, see alignment E=4.1e-51 PF07687: M20_dimer" amino acids 200 to 290 (91 residues), 41.4 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 35% identical to CBPX2_SACS2: Thermostable carboxypeptidase 2 (cpsA2) from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 99% identity to rpf:Rpic12D_1452)

Predicted SEED Role

"Metal-dependent amidase/aminoacylase/carboxypeptidase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>ABZR87_RS12400 M20 aminoacylase family protein (Ralstonia sp. UNC404CL21Col)
MTKAPTLTPFQLLPHLLPPVHIDAETFVNIRRQIHAQPELGFEVGATSTLVADLLKSWGY
EVHTGIGKSGVVGQLKLGNGTRRLGIRADMDALPIVEATGLPYASRNHGKMHACGHDGHT
AILLAAAKALAESRDFDGTLNLIFQPDEENLCGARAMIEDGLFERFPCDAVYALHNMPGV
PAGSFRVLPGPVSLSSDVADVTIKGMGGHGAMPHRARDPIAASAAIITALQTVVARNVAP
DDTAVVSVGFIRGGATHNVIPESVTIGLNVRAARPETRALVEMRIREIVSLTAQAHGVEA
QIDYRQLTPPMVNTEAETQLAQQVCTELVGAANVVTQAPKGLNGSEDFAWMLNEVPGCYL
ILGNGEGEFGGCMVHNPGYDFNDQVLPLGAAAWVRLAQTYLTA