Protein Info for ABZR87_RS12345 in Ralstonia sp. UNC404CL21Col

Annotation: dethiobiotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00347: dethiobiotin synthase
  • amino acids 8 to 178 (171 residues), 154.9 bits, E=1e-49
• PF13500: AAA_26
  • amino acids 8 to 212 (205 residues), 134.9 bits, E=3.3e-43
• PF01656: CbiA
  • amino acids 8 to 211 (204 residues), 35.7 bits, E=7.8e-13

Best Hits

Swiss-Prot: 96% identical to BIOD_RALPJ: ATP-dependent dethiobiotin synthetase BioD (bioD) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 96% identity to rpi:Rpic_1373)

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (4/4 steps found)
• biotin biosynthesis II (5/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Protein Sequence (235 amino acids)

>ABZR87_RS12345 dethiobiotin synthase (Ralstonia sp. UNC404CL21Col)
MPARFDCFVTGTDTEIGKTLVSAALLTKLADAGYRAAGLKPIAAGTLAGAPTRTNEDVEQ
LRAAASVDLPLDTVCPWLLDAPMSPHLAAAREGVTITLPPILDAVAHARSLADAVVVEGV
GGFRVPLSDNFDTAEMAVALGLPVVLVVGLRLGCLNHAALTAEAIAARGLHLTGWVGNVV
DASMAGLDDNVATLRRWINAPHLGTIPRLPHADARLAAAHVDIAPLLARPAETRR