Protein Info for ABZR87_RS12320 in Ralstonia sp. UNC404CL21Col

Annotation: benzoate 1,2-dioxygenase electron transfer component BenC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 209 to 229 (21 residues), see Phobius details PF00111: Fer2" amino acids 10 to 86 (77 residues), 57 bits, see alignment E=3e-19 PF00970: FAD_binding_6" amino acids 118 to 201 (84 residues), 51.8 bits, see alignment E=1.8e-17 PF00175: NAD_binding_1" amino acids 211 to 314 (104 residues), 76.3 bits, see alignment E=5.8e-25

Best Hits

Swiss-Prot: 56% identical to XYLZ_PSEPU: Toluate 1,2-dioxygenase electron transfer component (xylZ) from Pseudomonas putida

KEGG orthology group: K05784, benzoate 1,2-dioxygenase electron transfer component (inferred from 93% identity to rpf:Rpic12D_1430)

MetaCyc: 56% identical to XylZ (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"2-chlorobenzoate 1,2-dioxygenase reductase component"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>ABZR87_RS12320 benzoate 1,2-dioxygenase electron transfer component BenC (Ralstonia sp. UNC404CL21Col)
MSSFTVALNFEDGVTRFIDCKAGEKVLDAAFRAKINLPMDCSDGVCGTCKCRAESGSYDL
GDDYIDDALSEDEKNTGLVLTCQMVPHSDCVIAVPTSSTACKTGQSAFAATVSNVELHND
AAVVLELDVDAEAPVFLPGQYVNIGVPGSGQHRSYSFSSAPGESKISFLIKKIPDGVMSR
WLETAQPGDKLNLHGPLGSFYLRDVQRPLLFLAGGTGLAPFLSMLEVLARVNSQQKVHLI
YGVTRDLDLVQVDAIDAYAARLPNFSYATVVADAASNHPRKGWVTQHVPADALNDGDVDV
YLCGPPPMVDAVRKYFDDEGVKPSSFYYEKFTPNAVPEAKAA