Protein Info for ABZR87_RS12315 in Ralstonia sp. UNC404CL21Col

Annotation: benzoate 1,2-dioxygenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13577: SnoaL_4" amino acids 3 to 141 (139 residues), 28 bits, see alignment E=2e-10 TIGR03232: benzoate 1,2-dioxygenase, small subunit" amino acids 8 to 162 (155 residues), 247.9 bits, see alignment E=1.9e-78 PF00866: Ring_hydroxyl_B" amino acids 14 to 154 (141 residues), 171.9 bits, see alignment E=8.6e-55

Best Hits

Swiss-Prot: 63% identical to XYLY_PSEPU: Toluate 1,2-dioxygenase subunit beta (xylY) from Pseudomonas putida

KEGG orthology group: K08686, 2-chlorobenzoate 1,2-dioxygenase [EC: 1.14.12.13] (inferred from 96% identity to rpi:Rpic_1365)

MetaCyc: 63% identical to XylY (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10 or 1.14.12.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>ABZR87_RS12315 benzoate 1,2-dioxygenase small subunit (Ralstonia sp. UNC404CL21Col)
MSADYQNICAALYREARLLDDRQWDAWLDCYAEDVTYWMPAWDDDDQLTDDPQSQISLMY
YANRCGLEDRVFRIKTERSGASTPEPRTSHTVANVEVLAERGDEVDVRYNFHTLSHRYKT
TDHFFGTMFVTLRRAGDGFLIASKKIVLKNDYIRQVLDVYHV