Protein Info for ABZR87_RS12280 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 386 to 410 (25 residues), see Phobius details amino acids 429 to 443 (15 residues), see Phobius details amino acids 489 to 512 (24 residues), see Phobius details PF07690: MFS_1" amino acids 39 to 435 (397 residues), 104.9 bits, see alignment E=4.5e-34 PF06609: TRI12" amino acids 63 to 223 (161 residues), 31.3 bits, see alignment E=8.3e-12

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_1358)

Predicted SEED Role

"FIG00975614: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>ABZR87_RS12280 MFS transporter (Ralstonia sp. UNC404CL21Col)
MNTPSTDHTVSPPPAPRKPAAESTVGSRMELRMVGMVIGLATGVDYMSNLMFSIAGPHIE
GGVLASQDVYLWAVTAYAAAASLAILVMGRLADHMTYRRHTLLSLLVFIAGTLMCAAAEG
GTMLIVGRAVQGFGGGPMLSTSRIFVQHSPAHERRTMMKGMIYGIFGLSCVSPMLSAALT
EQFGWRAIFVAQLLVAVVVCGLVAAFYPHPQMHERKGDFASLDWPSAIAFGLAALIALHG
FQQARFIHPDGSPAQVVPIIAVVALILWVGIRQTGHPLPWVDLRATLQRRFLMGMVFYAI
YYMFASAWGFLSSSLLQNGLGFRYETTAQLMSLGGLVTVALGILNFQLTNVLPTKRVLIS
IGFVLMATALLWMSHVAMPGASVAAVAPGFMIEGMVGMFVVIQVAGLTYVDLPAKDFGHA
YQFKGIMRAWAQAFGTMGATLLLQRGQAQHRTDLVGHVSALTPAWQWPHALQGSELIRIS
AEIDRQATLLAVGDLFAWGAVVALGCAGGIWLQRSLR