Protein Info for ABZR87_RS12245 in Ralstonia sp. UNC404CL21Col

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13191: AAA_16
  • amino acids 23 to 155 (133 residues), 33.3 bits, E=1.7e-11
• PF13401: AAA_22
  • amino acids 35 to 156 (122 residues), 29.1 bits, E=2.7e-10
• PF07728: AAA_5
  • amino acids 37 to 192 (156 residues), 43.6 bits, E=7.8e-15
• PF00004: AAA
  • amino acids 39 to 192 (154 residues), 37.1 bits, E=1e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_1415)

Predicted SEED Role

"carbon monoxide dehydrogenase D protein" in subsystem CO Dehydrogenase or Carbon monoxide dehydrogenase maturation factors

Protein Sequence (298 amino acids)

>ABZR87_RS12245 MoxR family ATPase (Ralstonia sp. UNC404CL21Col)
MPVDSIDDCIAQLQGQGYFAGRELATALFLALRMQRPLFLEGEPGVGKTELAKAAAGLLG
TSLLRLQCYEGLDTASALYEWDYPRQIMALRLAEAAGEKPRADTLYRDEFLLKRPLLQAL
LPDLLHPDTPRVLLIDEIDRADEPFEAFLLELLSDFQVSIPEFGTVRAQVIPLVIMTSNR
TREVHDALKRRCLYQWIGYPDKARELQIVAQRAPETAARLQQRAVDFVHRLRGIDLFKAP
GIAEAIDWCRALAALNVTELDPQSVQDTLGVLLKYQDDLARVDRPTIEQLLAAPALPE