Protein Info for ABZR87_RS12090 in Ralstonia sp. UNC404CL21Col

Annotation: protocatechuate 3,4-dioxygenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR02423: protocatechuate 3,4-dioxygenase, alpha subunit" amino acids 30 to 231 (202 residues), 251 bits, see alignment E=4.2e-79 PF00775: Dioxygenase_C" amino acids 66 to 217 (152 residues), 64 bits, see alignment E=6.4e-22

Best Hits

Swiss-Prot: 62% identical to PCXA_ACIAD: Protocatechuate 3,4-dioxygenase alpha chain (pcaG) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K00448, protocatechuate 3,4-dioxygenase, alpha subunit [EC: 1.13.11.3] (inferred from 100% identity to rpf:Rpic12D_1383)

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase alpha chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>ABZR87_RS12090 protocatechuate 3,4-dioxygenase subunit alpha (Ralstonia sp. UNC404CL21Col)
MTTTTLRESLERAQATAMTTTPPFAHFNETASQTGGPYVHIGLAPRQAGFDIYDKEFGSV
LTTPATRGERIALEGRVYDGSGSLVRDVLIEIWQANADGKYAHPADRQDKPVDPAFRGWG
RAGADFDTGVYRFDTIKPGAVAGRSGTTQAPHICMILFARGINLGLHTRVYFSDEAAANG
TDPVLNGIEWEVRRKTLIAQRSERNGEVVYTFDVRLQDTPDGGAETVFFDI