Protein Info for ABZR87_RS12015 in Ralstonia sp. UNC404CL21Col

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 162 to 180 (19 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details PF08240: ADH_N" amino acids 24 to 130 (107 residues), 99.3 bits, see alignment E=3.6e-32 PF16912: Glu_dehyd_C" amino acids 150 to 334 (185 residues), 45.4 bits, see alignment E=1.8e-15 PF01262: AlaDh_PNT_C" amino acids 158 to 205 (48 residues), 23.9 bits, see alignment 6.3e-09 PF00107: ADH_zinc_N" amino acids 169 to 295 (127 residues), 81.6 bits, see alignment E=1.3e-26 PF13602: ADH_zinc_N_2" amino acids 203 to 316 (114 residues), 33.9 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: None (inferred from 75% identity to aaa:Acav_1657)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>ABZR87_RS12015 zinc-binding alcohol dehydrogenase family protein (Ralstonia sp. UNC404CL21Col)
MLTVVCETPGTLRALDRPVPSPADGEVLLRVKRVGVCGTDLHIFTGNQPYLNYPRVMGHE
LSGIVEQAPAGSALSKGDVVYVMPYLSCGHCVACRQGRTNCCVNIQVLGVHRDGAFTEYL
SVPQAFVHKADGVSLDQAAMVEFLAIGAHAVRRAQVRAGQRVLVVGAGPIGMAAMIFAKL
RGATVTALDSRADRLAFATEQLGVDASVALGDTDEAQLAALTDNEFYDVVFDATGNPKAM
ERGLRFVAHAGTYVLISVVAANLSFSDPEFHKRETTLLASRNATTEDFETVLDAMRAGKI
PAALNTHRMALADVPEHFKTLLDPAAGVVKAIVEC