Protein Info for ABZR87_RS12010 in Ralstonia sp. UNC404CL21Col

Annotation: D-mannonate oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF01232: Mannitol_dh" amino acids 5 to 227 (223 residues), 42.4 bits, see alignment E=8.2e-15 PF08125: Mannitol_dh_C" amino acids 246 to 359 (114 residues), 47.7 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: K00041, tagaturonate reductase [EC: 1.1.1.58] (inferred from 69% identity to pna:Pnap_2069)

Predicted SEED Role

"Altronate oxidoreductase (EC 1.1.1.58)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.58)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.58

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>ABZR87_RS12010 D-mannonate oxidoreductase (Ralstonia sp. UNC404CL21Col)
MTAPILQFGTSRFLQAHVDLFVSEALDAGQALGGITVVQTTANPASAARVAALAGGAGYP
VRIRGLRDGTPVDKTVTCRAVQRALQADADWEQLRDLMATDVQVVVSNTADQGYQLDPRD
DARLIQQPSRVPRSFPAKLVALLLGRWLRQPHAPLSLFPCELIERNGDTLCATVCALARQ
WALPTAFVDWLPTHCVWANSLVDRIVSEALHPVGAVAEPYALWAIERRPGLVLPCTHPAI
VLTDELDHHERLKLFLLNAGHTFLAERWREDAHPADMTVAQAMEDARLRPELEALWHDEI
VPVFTALGKRDAAEAYLVLLRERLLNPYLAHRLADIAQNHAQKKQRRLAPIVALARQLGL
HLAQPRLNAALANPN