Protein Info for ABZR87_RS11960 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details PF00892: EamA" amino acids 3 to 111 (109 residues), 35.5 bits, see alignment E=5.3e-13

Best Hits

KEGG orthology group: None (inferred from 92% identity to rpf:Rpic12D_1369)

Predicted SEED Role

"FIG006442: Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>ABZR87_RS11960 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MGIGVLCALLAGAMWGMVFIAPRALPAFSPWELTLGRYLAYGVIAAIAAGPILPRIARKI
TRADCLALVRQSCSGNLVYYVLLAFAVQLAGVAPTSLIIGILPITVTVLGRRDHGAVQLS
RLIWPLLVVAAGIVCINVDLFGHQATAAATNVRPIWQRVAGIVCAAGALCSWTWYAVDNA
RYLQRNPHFSSNEWSALYGISSGILSAALITVALLTVGTAWMGAGGRIWGTFWAVNAAVA
LGASLIGNNLWNIASRRLPLTLSGQMIVFETLFALAYGFVYDSRWPRPLEIAAIALLILG
VGWSVRLHANDKSA