Protein Info for ABZR87_RS11775 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 285 to 302 (18 residues), see Phobius details PF00892: EamA" amino acids 20 to 148 (129 residues), 36.2 bits, see alignment E=3.3e-13 amino acids 163 to 298 (136 residues), 40.9 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_1332)

Predicted SEED Role

"PROBABLE TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>ABZR87_RS11775 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MTSIASSADASAHHEPQWAAALFILLGASVWGISWYPYRLLAGWGLGSMLASSMTGAAAA
VLAAVVLRRHFSTFQWSWLIPALGIAAGITNAGFVWGTVHGTVMRVLLLFYLTPVWTALL
ARLWLHERLGWRGGVLLALALSGAVMMLWSGQAGTPWPGSAAEWAGLIAGLAFACNNVLS
RLAGQRHPTMRPEMRTVVVFTGCALVGFPAALMLDGVRTVPAAFSQGNTWLLLAGMACVL
VGGNAMVQRGLQRLPANRAALLMLFEIVVAAVSSALLTAERLSPQEMVGGACIILAGALS
GLSRRK