Protein Info for ABZR87_RS11720 in Ralstonia sp. UNC404CL21Col

Annotation: glutathione ABC transporter permease GsiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details PF12911: OppC_N" amino acids 20 to 73 (54 residues), 58.6 bits, see alignment E=4.4e-20 PF00528: BPD_transp_1" amino acids 114 to 297 (184 residues), 121.1 bits, see alignment E=4.9e-39

Best Hits

Swiss-Prot: 76% identical to GSID_ECOL5: Glutathione transport system permease protein GsiD (gsiD) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K13891, glutathione transport system permease protein (inferred from 99% identity to rpf:Rpic12D_1321)

MetaCyc: 77% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>ABZR87_RS11720 glutathione ABC transporter permease GsiD (Ralstonia sp. UNC404CL21Col)
MTQAASQAVAPQAATEPVRTPWTEFWRKFRKQHLAMGAGVFVIALVLIAILAPHIVPFDP
ENYFDYDALNAGPSAQHWFGVDSLGRDIFSRILMGTRISLEAGFVSVIIGAIVGTMLGLL
AGYYEGWWDRIVMRISDVLFAFPGILLAIGIVAILGNGMINVIFAVAVFSIPAFARLVRG
NTLMLKHLTYVEAARSIGASDWTIIMRHILPGTISSIVVYFSMRIGTSIITAASLSFLGL
GAQPPTPEWGAMLNEARADMVTAPHVAIFPSLAIFLTVLAFNLLGDGLRDALDPKIDRR