Protein Info for ABZR87_RS11670 in Ralstonia sp. UNC404CL21Col

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 TIGR00416: DNA repair protein RadA" amino acids 1 to 448 (448 residues), 652.1 bits, see alignment E=2.1e-200 PF18073: Rubredoxin_2" amino acids 8 to 35 (28 residues), 43.1 bits, see alignment (E = 9.3e-15) PF13481: AAA_25" amino acids 66 to 219 (154 residues), 68.9 bits, see alignment E=1.7e-22 PF06745: ATPase" amino acids 72 to 142 (71 residues), 40.8 bits, see alignment E=6e-14 amino acids 154 to 249 (96 residues), 32.1 bits, see alignment E=2.7e-11 PF13401: AAA_22" amino acids 89 to 214 (126 residues), 31 bits, see alignment E=1e-10 PF05362: Lon_C" amino acids 361 to 449 (89 residues), 23.4 bits, see alignment E=1.4e-08

Best Hits

Swiss-Prot: 61% identical to RADA_PSEAE: DNA repair protein RadA (radA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 99% identity to rpi:Rpic_1245)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>ABZR87_RS11670 DNA repair protein RadA (Ralstonia sp. UNC404CL21Col)
MAKSKTVYTCTECGGTAPKWAGQCPNCQQWNTLVETVAQPTSGAGARFQSLASSATVRKL
SDIDAVDVPRFSSGIDEFDRVLGGGLVSGGVVLIGGDPGIGKSTLLLQALSNLSTDRRVL
YVSGEESGSQIALRARRLGIESPNLALLAEIQLERIQATIEAEKPEVVVIDSIQTLYSEA
LTSAPGSVAQVRECAAQLTRIAKRLDVTTILVGHVTKEGALAGPRVLEHIVDTVLYFEGD
THSAYRLVRAFKNRFGAVNELGVFAMTERGLRGVANPSALFLSQHEQVVPGSCVLVTQEG
TRPLLVEIQALVDTANVPNPRRLAVGLEQNRLAMLLAVLHRHAGIACFDQDVFLNAVGGV
KITEPAADLAVLLAIHSSMRNKALPRGLVVFGEIGLAGEIRPTPRGQERLKEAAKLGFSI
AVIPKSNVPKQAIDGLEVIAVERIEQAIDRVRSLEA