Protein Info for ABZR87_RS11650 in Ralstonia sp. UNC404CL21Col

Annotation: ribosomal protein S18-alanine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 transmembrane" amino acids 103 to 122 (20 residues), see Phobius details TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 30 to 163 (134 residues), 113.7 bits, see alignment E=3.4e-37 PF00583: Acetyltransf_1" amino acids 39 to 140 (102 residues), 53.8 bits, see alignment E=4.8e-18 PF13673: Acetyltransf_10" amino acids 47 to 146 (100 residues), 37.7 bits, see alignment E=3.8e-13 PF08445: FR47" amino acids 60 to 145 (86 residues), 29.5 bits, see alignment E=1.2e-10 PF13508: Acetyltransf_7" amino acids 62 to 141 (80 residues), 42.2 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 90% identity to rpi:Rpic_1241)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>ABZR87_RS11650 ribosomal protein S18-alanine N-acetyltransferase (Ralstonia sp. UNC404CL21Col)
MSLIDNALARVITQAPLPAGWRAERMTARDLEGVAAVELAAFKFPWSRGNFEDSLKSGHL
GIVLRDGGNEVAGYLILMPVVDEMHLLNVTVAPAWQRQGLGHWLMRLATALTLVHGFGSL
LLEVRPSNTGAIALYHRIGFAEIGRRKRYYPAENNTREDALVMRMVCEASGVEAA