Protein Info for ABZR87_RS11635 in Ralstonia sp. UNC404CL21Col

Annotation: DHA2 family efflux MFS transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 214 to 231 (18 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 341 to 358 (18 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details amino acids 449 to 470 (22 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 23 to 427 (405 residues), 266.8 bits, see alignment E=1.9e-83 PF13347: MFS_2" amino acids 26 to 176 (151 residues), 30.8 bits, see alignment E=1.2e-11 PF07690: MFS_1" amino acids 27 to 417 (391 residues), 155.8 bits, see alignment E=1.5e-49

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpi:Rpic_1238)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>ABZR87_RS11635 DHA2 family efflux MFS transporter permease subunit (Ralstonia sp. UNC404CL21Col)
MTTFTPTLEALRARYGERFKWLVLFTLMVGAVSSVISATIVNVAIPDLSRHFVLGQERAQ
WVSASFMVAMTLSMLLTPWLLLRFGLRRTFIGALLLLGVGGLAGGLSPNYEVMIAMRVVE
GIAAGIMQPLPNILILRVFPEREQGKAFGLFGFGVVLAPAVGPSVGGFLVELFGWRSIFF
VVMPFTLIGWAMARRFMAINSSMAGEPKPLDWRGLLLIGGATVTLLNGLVALHGDVAHGV
VLMLVSAVCLAGFVFWQRRVESPLLNLRLFSYRQFAMGAVVAFIYGAGLYGSTYLVPVYM
QVALAYAPSRAGLVLLPAGLVLAVTIMLAGRLTNRIEPFRLVSFGLAALALSFFLMATNT
RATSYLLLIAIAVIGRIGLGFVLPSLSLGAMRGVDFTLIAQGSSAVNFLRQLGGAIGVSA
TGIFLQWRLATRGIETVHGAAVDPEARILAFDETFVFLGTLCALAVLAAWRMRRRELPSA
IPAAQ