Protein Info for ABZR87_RS11625 in Ralstonia sp. UNC404CL21Col

Annotation: malate synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20656: MS_N
  • amino acids 8 to 69 (62 residues), 73.2 bits, E=1.4e-24
• TIGR01344: malate synthase A
  • amino acids 22 to 526 (505 residues), 754.9 bits, E=1.5e-231
• PF01274: MS_TIM-barrel
  • amino acids 160 to 404 (245 residues), 352.5 bits, E=1.3e-109
• PF20659: MS_C
  • amino acids 411 to 526 (116 residues), 135.7 bits, E=1.5e-43

Best Hits

Swiss-Prot: 57% identical to MASY_MYXXD: Malate synthase (mls) from Myxococcus xanthus (strain DK 1622)

KEGG orthology group: K01638, malate synthase [EC: 2.3.3.9] (inferred from 99% identity to rpi:Rpic_1236)

MetaCyc: 51% identical to malate synthase (Arabidopsis thaliana col)
Malate synthase. [EC: 2.3.3.9]

Predicted SEED Role

"Malate synthase (EC 2.3.3.9)" in subsystem Photorespiration (oxidative C2 cycle) (EC 2.3.3.9)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• glycolate and glyoxylate degradation II (2/2 steps found)
• L-arabinose degradation IV (6/8 steps found)
• D-xylose degradation IV (5/7 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• chitin deacetylation (2/4 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (2/14 steps found)
• superpathway of pentose and pentitol degradation (17/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.9

Protein Sequence (526 amino acids)

>ABZR87_RS11625 malate synthase A (Ralstonia sp. UNC404CL21Col)
MALTLPQGMEIKAEILPAYEDILTPEALALVAKLHRAFQPRRKELLASRVERAKRLDAGE
RPDFLPETKAVREGDWKVAPIPPALHCRRVEITGPVDAKMVINAFNSGADSYMTDFEDSN
SPSWHNQIQGQVNLKAAIRRTLTLEQNGKTYKLNDKIATLQVRPRGWHLDEKHVLIDGER
VSGGIFDFALFLFHNAKEQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKVDKNFCLADRAKVTM
TSPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMAGIINDKKRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGDKPNQFEKQRPDVEVKAADLLDFQPETPITEAGLRMNI
NVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKETGAVGHFDRAAEIFEQMSTSEDFAEFLTLPLYEEI